galanin-like peptide


SMILES None
InChIKey None
Sequence APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLAS

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Physiological/Surrogate Surrogate
Approved drug No

Database connections

Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
GAL2 GALR2 Rat Galanin A pIC50 9.62 9.62 9.62 Guide to Pharmacology
GAL2 GALR2 Rat Galanin A pEC50 8.62 8.62 8.62 Guide to Pharmacology
GAL1 GALR1 Rat Galanin A pIC50 8.37 8.37 8.37 Guide to Pharmacology
GAL1 GALR1 Rat Galanin A pEC50 7.52 7.52 7.52 Guide to Pharmacology